- Sequence
- DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
- CAS Number
- 131438-79-4
- Molecular Formula
- —
- Molecular Weight
- 4329.9
- Purity
- ≥95%
- Category
- Neuroscience
- Storage
- Store lyophilized at -20°C.
- Appearance
- Lyophilized solid (typical)
- Solubility
- Depends on sequence; test a small aliquot first.
Amyloid-beta 1-40 peptide for comparative aggregation studies.
Neurodegeneration research.
Molecular formula is omitted when it is not confirmed for the salt form supplied. Do not treat an empty field as a value of zero.
This catalog item is supplied for laboratory research only and is not intended for direct human use. Need a labelled or truncated analogue? Use custom peptide synthesis.
Related category: Neuropeptides peptides.