Antimicrobial research peptides in the catalog are membrane-active sequences used in biophysics and host-defense studies. They are not formulated medicines and are not supplied for clinical use. Concentrated solutions can be cytotoxic in cell assays; handle them under your institutional rules. Analogues with altered charge or hydrophobicity are custom projects. LL-37, magainin 2 and melittin are examples of well-known sequences that laboratories use as reference peptides. Confirm the exact residue string, including amidation, against the clone you already cite. Catalog HPLC purity is not a sterility claim and is not an endotoxin specification unless a project explicitly adds those tests. Related quality-control notes explain what a standard peptide CoA does and does not include. If you need a labeled analogue for microscopy, use fluorescent peptide synthesis rather than assuming a dye can be added to a stock vial. Storage of hydrophobic membrane peptides often needs careful reconstitution; test a small aliquot first.
If the analogue you need is not listed, request custom peptide synthesis with the exact sequence and purity.
- LL-37[LL-37, 37 aa]
- Magainin 2GIGKFLHSAKKFGKAFVGEIMNS
- MelittinGIGAVLKVLTTGLPALISWIKRKRQQ-NH2
