- Sequence
- YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
- CAS Number
- 82785-45-3
- Molecular Formula
- —
- Molecular Weight
- 4254.7
- Purity
- ≥95%
- Category
- Neuropeptides
- Storage
- Store lyophilized at -20°C.
- Appearance
- Lyophilized solid (typical)
- Solubility
- Depends on sequence; test a small aliquot first.
36-residue NPY for appetite and receptor research.
Neuroscience research.
Molecular formula is omitted when it is not confirmed for the salt form supplied. Do not treat an empty field as a value of zero.
This catalog item is supplied for laboratory research only and is not intended for direct human use. Need a labelled or truncated analogue? Use custom peptide synthesis.
Related category: Neuropeptides peptides.