- Sequence
- HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
- CAS Number
- 37221-79-7
- Molecular Formula
- —
- Molecular Weight
- 3325.8
- Purity
- ≥95%
- Category
- Neuropeptides
- Storage
- Store lyophilized at -20°C.
- Appearance
- Lyophilized solid (typical)
- Solubility
- Depends on sequence; test a small aliquot first.
Vasoactive intestinal peptide for GPCR research.
Immunology and neuroscience research.
Molecular formula is omitted when it is not confirmed for the salt form supplied. Do not treat an empty field as a value of zero.
This catalog item is supplied for laboratory research only and is not intended for direct human use. Need a labelled or truncated analogue? Use custom peptide synthesis.
Related category: Neuropeptides peptides.